SCOP 1.65: Domain d1e9ya1: 1e9y A:106-238

Lineage for d1e9ya1 (1e9y A:106-238)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Helicobacter pylori [TaxId:210] [69367] (2 PDB entries)
   fused with gamma subunit

8. Domain d1e9ya1: 1e9y A:106-238 [64846]
   Other proteins in same PDB: d1e9ya2, d1e9yb1, d1e9yb2
   complexed with hae, ni

Details for d1e9ya1

PDB Entry: 1e9y, 3 Å

PDB Description: crystal structure of helicobacter pylori urease in complex with acetohydroxamic acid

SCOP Domain Sequences for d1e9ya1:

Sequence; same for both SEQRES and ATOM records:

>d1e9ya1 b.85.3.1 (A:106-238) Urease, beta-subunit {Helicobacter pylori}
lvpgelflkneditinegkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkr
ldiaagtavrfepgeeksvelidiggnrrifgfnalvdrqadneskkialhrakergfhg
aksddnyvktike

Timeline for d1e9ya1:

• d1e9ya1 first appeared in SCOP 1.59
  
• d1e9ya1 appears in SCOP 1.63
  
• d1e9ya1 appears in SCOP 1.67
  
• d1e9ya1 appears in the current release, SCOPe 2.08