![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein Urease, beta-subunit [51280] (4 species) |
![]() | Species Helicobacter pylori [TaxId:210] [69367] (2 PDB entries) fused with gamma subunit |
![]() | Domain d1e9ya1: 1e9y A:106-238 [64846] Other proteins in same PDB: d1e9ya2, d1e9yb1, d1e9yb2 complexed with hae, ni |
PDB Entry: 1e9y (more details), 3 Å
SCOPe Domain Sequences for d1e9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e9ya1 b.85.3.1 (A:106-238) Urease, beta-subunit {Helicobacter pylori [TaxId: 210]} lvpgelflkneditinegkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkr ldiaagtavrfepgeeksvelidiggnrrifgfnalvdrqadneskkialhrakergfhg aksddnyvktike
Timeline for d1e9ya1: