SCOPe 2.08: Domain d1e9hb2: 1e9h B:310-432

Lineage for d1e9hb2 (1e9h B:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d1e9hb2: 1e9h B:310-432 [64814]
   Other proteins in same PDB: d1e9ha_, d1e9hc1, d1e9hc2
   complexed with inr

Details for d1e9hb2

PDB Entry: 1e9h, 2.5 Å

PDB Description: thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound

PDB Compounds: (B:) cyclin a3

SCOPe Domain Sequences for d1e9hb2:

Sequence; same for both SEQRES and ATOM records:

>d1e9hb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1e9hb2:

• d1e9hb2 first appeared in SCOP 1.59
  
• d1e9hb2 appears in SCOPe 2.07