![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) ![]() |
![]() | Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) automatically mapped to Pfam PF07498 |
![]() | Protein Rho termination factor, N-terminal domain [68914] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) Uniprot P03002 |
![]() | Domain d2a8vc1: 2a8v C:1-47 [64756] Other proteins in same PDB: d2a8va2, d2a8vb2, d2a8vc2 protein/RNA complex |
PDB Entry: 2a8v (more details), 2.4 Å
SCOPe Domain Sequences for d2a8vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8vc1 a.140.3.1 (C:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d2a8vc1:
![]() Domains from other chains: (mouse over for more information) d2a8va1, d2a8va2, d2a8vb1, d2a8vb2 |