Lineage for d1ig8a1 (1ig8 A:18-224)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182134Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 182135Protein Hexokinase [53084] (2 species)
  7. 182136Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry)
  8. 182137Domain d1ig8a1: 1ig8 A:18-224 [64746]

Details for d1ig8a1

PDB Entry: 1ig8 (more details), 2.2 Å

PDB Description: Crystal Structure of Yeast Hexokinase PII with the correct amino acid sequence

SCOP Domain Sequences for d1ig8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII}
dvpkelmqqienfekiftvptetlqavtkhfiselekglskkggnipmipgwvmdfptgk
esgdflaidlggtnlrvvlvklggdrtfdttqskyrlpdamrttqnpdelwefiadslka
fideqfpqgisepiplgftfsfpasqnkinegilqrwtkgfdipnienhdvvpmlqkqit
krnipievvalindttgtlvasyytdp

SCOP Domain Coordinates for d1ig8a1:

Click to download the PDB-style file with coordinates for d1ig8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ig8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ig8a2