Lineage for d1dl5a1 (1dl5 A:1-213)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500829Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
    automatically mapped to Pfam PF01135
  6. 2500830Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 2500847Species Thermotoga maritima [TaxId:2336] [68928] (1 PDB entry)
  8. 2500848Domain d1dl5a1: 1dl5 A:1-213 [64720]
    Other proteins in same PDB: d1dl5a2, d1dl5b2
    complexed with cd, cl, sah

Details for d1dl5a1

PDB Entry: 1dl5 (more details), 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d1dl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}
mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
rrqpaflfkkkdpylvgnykletrfitaggnlg

SCOPe Domain Coordinates for d1dl5a1:

Click to download the PDB-style file with coordinates for d1dl5a1.
(The format of our PDB-style files is described here.)

Timeline for d1dl5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dl5a2