Lineage for d1a63_1 (1a63 1-47)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449631Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 449656Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 449657Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 449658Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 449659Species Escherichia coli [TaxId:562] [50295] (6 PDB entries)
  8. 449676Domain d1a63_1: 1a63 1-47 [64710]
    Other proteins in same PDB: d1a63_2

Details for d1a63_1

PDB Entry: 1a63 (more details)

PDB Description: the nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures

SCOP Domain Sequences for d1a63_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a63_1 a.140.3.1 (1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1a63_1:

Click to download the PDB-style file with coordinates for d1a63_1.
(The format of our PDB-style files is described here.)

Timeline for d1a63_1:

449676
d1a63_1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1a63_2