SCOPe 2.08: Domain d1a63a1: 1a63 A:1-47

Lineage for d1a63a1 (1a63 A:1-47)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families)

5. Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
   automatically mapped to Pfam PF07498

6. Protein Rho termination factor, N-terminal domain [68914] (1 species)

7. Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
   Uniprot P03002

8. Domain d1a63a1: 1a63 A:1-47 [64710]
   Other proteins in same PDB: d1a63a2

Details for d1a63a1

PDB Entry: 1a63

PDB Description: the nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures

PDB Compounds: (A:) rho

SCOPe Domain Sequences for d1a63a1:

Sequence; same for both SEQRES and ATOM records:

>d1a63a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

Timeline for d1a63a1:

• d1a63a1 first appeared in SCOP 1.59, called d1a63_1
  
• d1a63a1 appears in SCOPe 2.07