SCOP 1.75: Domain d1a62a2: 1a62 A:48-125

Lineage for d1a62a2 (1a62 A:48-125)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
   Uniprot P03002

8. Domain d1a62a2: 1a62 A:48-125 [64709]
   Other proteins in same PDB: d1a62a1

Details for d1a62a2

PDB Entry: 1a62, 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

PDB Compounds: (A:) rho

SCOP Domain Sequences for d1a62a2:

Sequence; same for both SEQRES and ATOM records:

>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpe

Timeline for d1a62a2:

• d1a62a2 first appeared in SCOP 1.59, called d1a62_2
  
• d1a62a2 appears in SCOP 1.73
  
• d1a62a2 appears in SCOPe 2.01
  
• d1a62a2 appears in the current release, SCOPe 2.08