Lineage for d1a62a2 (1a62 A:48-125)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383350Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 2383351Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 2383352Domain d1a62a2: 1a62 A:48-125 [64709]
    Other proteins in same PDB: d1a62a1

Details for d1a62a2

PDB Entry: 1a62 (more details), 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho
PDB Compounds: (A:) rho

SCOPe Domain Sequences for d1a62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpe

SCOPe Domain Coordinates for d1a62a2:

Click to download the PDB-style file with coordinates for d1a62a2.
(The format of our PDB-style files is described here.)

Timeline for d1a62a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a62a1