Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) |
Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (4 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
Protein 4-oxalocrotonate tautomerase [55333] (2 species) |
Species Pseudomonas putida, XylH [TaxId:303] [55335] (4 PDB entries) |
Domain d4otbh_: 4otb H: [63365] |
PDB Entry: 4otb (more details), 2.5 Å
SCOP Domain Sequences for d4otbh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4otbh_ d.80.1.1 (H:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH} piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelask
Timeline for d4otbh_: