Lineage for d4otbb_ (4otb B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506749Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 506750Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) (S)
  5. 506751Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (4 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 506752Protein 4-oxalocrotonate tautomerase [55333] (2 species)
  7. 506753Species Pseudomonas putida, XylH [TaxId:303] [55335] (4 PDB entries)
  8. 506769Domain d4otbb_: 4otb B: [63359]

Details for d4otbb_

PDB Entry: 4otb (more details), 2.5 Å

PDB Description: 4-oxalocrotonate tautomerase observed as an octodecamer, rhombohedral crystal form

SCOP Domain Sequences for d4otbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otbb_ d.80.1.1 (B:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelask

SCOP Domain Coordinates for d4otbb_:

Click to download the PDB-style file with coordinates for d4otbb_.
(The format of our PDB-style files is described here.)

Timeline for d4otbb_: