Lineage for d1jwoa_ (1jwo A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Csk homologous kinase Chk [64345] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64346] (1 PDB entry) 
Domain d1jwoa_: 1jwo A: [63310]
Details for d1jwoa_
PDB Entry: 1jwo (more details), 2.5 Å
PDB Description: Crystal Structure Analysis of the SH2 Domain of the Csk Homologous Kinase CHK
SCOP Domain Sequences for d1jwoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens)}
lslmpwfhgkisgqeavqqlqppedglflvresarhpgdyvlcvsfgrdvihyrvlhrdg
hltideavffcnlmdmvehyskdkgaictklvrpkrk
SCOP Domain Coordinates for d1jwoa_:
Click to download the PDB-style file with coordinates for d1jwoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jwoa_:
- d1jwoa_ is new in SCOP 1.57
- d1jwoa_ appears in SCOP 1.59
- d1jwoa_ appears in the current release, SCOPe 2.08
View in 3D