Lineage for d1jwoa_ (1jwo A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82490Protein Csk homologous kinase Chk [64345] (1 species)
  7. 82491Species Human (Homo sapiens) [TaxId:9606] [64346] (1 PDB entry)
  8. 82492Domain d1jwoa_: 1jwo A: [63310]

Details for d1jwoa_

PDB Entry: 1jwo (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of the SH2 Domain of the Csk Homologous Kinase CHK

SCOP Domain Sequences for d1jwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens)}
lslmpwfhgkisgqeavqqlqppedglflvresarhpgdyvlcvsfgrdvihyrvlhrdg
hltideavffcnlmdmvehyskdkgaictklvrpkrk

SCOP Domain Coordinates for d1jwoa_:

Click to download the PDB-style file with coordinates for d1jwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1jwoa_: