PDB entry 1jwo

View 1jwo on RCSB PDB site
Description: Crystal Structure Analysis of the SH2 Domain of the Csk Homologous Kinase CHK
Deposited on 2001-09-04, released 2001-09-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-12, with a file datestamp of 2001-09-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1jwoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jwoA (A:)
  lslmpwfhgkisgqeavqqlqppedglflvresarhpgdyvlcvsfgrdvihyrvlhrdg
  hltideavffcnlmdmvehyskdkgaictklvrpkrk