Lineage for d1jtzy_ (1jtz Y:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662857Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 662858Species Mouse (Mus musculus) [TaxId:10090] [63722] (3 PDB entries)
  8. 662866Domain d1jtzy_: 1jtz Y: [63287]

Details for d1jtzy_

PDB Entry: 1jtz (more details), 2.6 Å

PDB Description: crystal structure of trance/rankl cytokine.
PDB Compounds: (Y:) tumor necrosis factor ligand superfamily member 11

SCOP Domain Sequences for d1jtzy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtzy_ b.22.1.1 (Y:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOP Domain Coordinates for d1jtzy_:

Click to download the PDB-style file with coordinates for d1jtzy_.
(The format of our PDB-style files is described here.)

Timeline for d1jtzy_: