Lineage for d1jtzy_ (1jtz Y:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.22: TNF-like [49841] (1 superfamily) Superfamily b.22.1: TNF-like [49842] (1 family) 
Family b.22.1.1: TNF-like [49843] (5 proteins) 
Protein TRANCE/RANKL cytokine [63721] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [63722] (1 PDB entry) 
Domain d1jtzy_: 1jtz Y: [63287]
Details for d1jtzy_
PDB Entry: 1jtz (more details), 2.6 Å
PDB Description: crystal structure of trance/rankl cytokine.
SCOP Domain Sequences for d1jtzy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtzy_ b.22.1.1 (Y:) TRANCE/RANKL cytokine {Mouse (Mus musculus)}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdid
SCOP Domain Coordinates for d1jtzy_:
Click to download the PDB-style file with coordinates for d1jtzy_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtzy_:
- d1jtzy_ is new in SCOP 1.57
- d1jtzy_ appears in SCOP 1.59
- d1jtzy_ appears in the current release, SCOPe 2.08
View in 3D
