Lineage for d1jtqb_ (1jtq B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (45 PDB entries) 
Domain d1jtqb_: 1jtq B: [63283]
Details for d1jtqb_
PDB Entry: 1jtq (more details), 2.5 Å
PDB Description: e. coli ts complex with dump and the pyrrolo(2,3-d)pyrimidine-based antifolate ly341770
SCOP Domain Sequences for d1jtqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtqb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1jtqb_:
Click to download the PDB-style file with coordinates for d1jtqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtqb_:
- d1jtqb_ first appeared in SCOP 1.57
- d1jtqb_ appears in SCOP 1.61
- d1jtqb_ appears in the current release, SCOPe 2.08
View in 3D
