Lineage for d1jr3e1 (1jr3 E:208-334)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092611Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1092612Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1092613Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 1092614Protein delta prime subunit [48021] (1 species)
  7. 1092615Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
    Uniprot P28631
  8. 1092617Domain d1jr3e1: 1jr3 E:208-334 [63253]
    Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e2
    protein/DNA complex; complexed with so4, zn

Details for d1jr3e1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (E:) DNA polymerase III, delta' subunit

SCOPe Domain Sequences for d1jr3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3e1 a.80.1.1 (E:208-334) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

SCOPe Domain Coordinates for d1jr3e1:

Click to download the PDB-style file with coordinates for d1jr3e1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3e1: