Lineage for d1jqsa_ (1jqs A:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 272799Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 272800Protein 70S ribosome functional complex [58121] (2 species)
  7. 272801Species Escherichia coli [TaxId:562] [58123] (10 PDB entries)
  8. 272827Domain d1jqsa_: 1jqs A: [63237]

Details for d1jqsa_

PDB Entry: 1jqs (more details)

PDB Description: Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of E. coli 70S ribosome bound with EF-G and GMPPCP, a nonhydrolysable GTP analog

SCOP Domain Sequences for d1jqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqsa_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d1jqsa_:

Click to download the PDB-style file with coordinates for d1jqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jqsa_: