SCOP 1.61: Domain d1jnxx2: 1jnx X:1758-1859

Lineage for d1jnxx2 (1jnx X:1758-1859)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)

4. Superfamily c.15.1: BRCT domain [52113] (4 families)

5. Family c.15.1.3: Breast cancer associated protein, BRCA1 [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (1 PDB entry)

8. Domain d1jnxx2: 1jnx X:1758-1859 [63202]

Details for d1jnxx2

PDB Entry: 1jnx, 2.5 Å

PDB Description: crystal structure of the brct repeat region from the breast cancer associated protein, brca1

SCOP Domain Sequences for d1jnxx2:

Sequence, based on SEQRES records:

>d1jnxx2 c.15.1.3 (X:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens)}
rkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawte
dngfhaigqmceapvvtrewvldsvalyqcqeldtylipqip

Sequence, based on observed residues (ATOM records):

>d1jnxx2 c.15.1.3 (X:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens)}
rkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtg
fhaigqmceapvvtrewvldsvalyqcqeldtylipqip

Timeline for d1jnxx2:

• d1jnxx2 first appeared in SCOP 1.57
  
• d1jnxx2 appears in SCOP 1.59
  
• d1jnxx2 appears in SCOP 1.63
  
• d1jnxx2 appears in the current release, SCOPe 2.08