SCOPe 2.07: Domain d1jl8a1: 1jl8 A:1-120

Lineage for d1jl8a1 (1jl8 A:1-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries)

8. Domain d1jl8a1: 1jl8 A:1-120 [63163]
   Other proteins in same PDB: d1jl8a2, d1jl8a3, d1jl8b2, d1jl8b3
   complexed with bcd

Details for d1jl8a1

PDB Entry: 1jl8, 3.2 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with beta-cyclodextrin based on a co-crystallization with methyl beta-cyclodextrin

PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1jl8a1:

Sequence; same for both SEQRES and ATOM records:

>d1jl8a1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1jl8a1:

• d1jl8a1 first appeared in SCOP 1.57
  
• d1jl8a1 appears in SCOPe 2.06
  
• d1jl8a1 appears in the current release, SCOPe 2.08