SCOP 1.73: Domain d1jl4a1: 1jl4 A:82-181

Lineage for d1jl4a1 (1jl4 A:82-181)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1jl4a1: 1jl4 A:82-181 [63157]
   Other proteins in same PDB: d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2

Details for d1jl4a1

PDB Entry: 1jl4, 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

PDB Compounds: (A:) h-2 class II histocompatibility antigen, a-k alpha chain

SCOP Domain Sequences for d1jl4a1:

Sequence; same for both SEQRES and ATOM records:

>d1jl4a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d1jl4a1:

• d1jl4a1 first appeared in SCOP 1.57
  
• d1jl4a1 appears in SCOP 1.71
  
• d1jl4a1 appears in SCOP 1.75
  
• d1jl4a1 appears in the current release, SCOPe 2.08