Lineage for d1jl4a1 (1jl4 A:82-181)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53214Species Mouse (Mus musculus), I-AK [TaxId:10090] [49138] (3 PDB entries)
  8. 53221Domain d1jl4a1: 1jl4 A:82-181 [63157]
    Other proteins in same PDB: d1jl4a2, d1jl4b2, d1jl4d1, d1jl4d2

Details for d1jl4a1

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4a1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1jl4a1:

Click to download the PDB-style file with coordinates for d1jl4a1.
(The format of our PDB-style files is described here.)

Timeline for d1jl4a1: