Lineage for d1jk8a1 (1jk8 A:85-181)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53153Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [63663] (1 PDB entry)
  8. 53154Domain d1jk8a1: 1jk8 A:85-181 [63145]
    Other proteins in same PDB: d1jk8a2, d1jk8b2

Details for d1jk8a1

PDB Entry: 1jk8 (more details), 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

SCOP Domain Sequences for d1jk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk8a1 b.1.1.2 (A:85-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DQ8}
evpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs
ffkisyltflpsddeiydckvehwgldepllkhwepe

SCOP Domain Coordinates for d1jk8a1:

Click to download the PDB-style file with coordinates for d1jk8a1.
(The format of our PDB-style files is described here.)

Timeline for d1jk8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jk8a2