| Class b: All beta proteins [48724] (104 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species) |
| Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [63663] (1 PDB entry) |
| Domain d1jk8a1: 1jk8 A:85-181 [63145] Other proteins in same PDB: d1jk8a2, d1jk8b2 |
PDB Entry: 1jk8 (more details), 2.4 Å
SCOP Domain Sequences for d1jk8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk8a1 b.1.1.2 (A:85-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DQ8}
evpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs
ffkisyltflpsddeiydckvehwgldepllkhwepe
Timeline for d1jk8a1: