Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species) |
Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [63663] (1 PDB entry) |
Domain d1jk8b1: 1jk8 B:95-192 [63147] Other proteins in same PDB: d1jk8a2, d1jk8b2 |
PDB Entry: 1jk8 (more details), 2.4 Å
SCOP Domain Sequences for d1jk8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk8b1 b.1.1.2 (B:95-192) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DQ8} veptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwt fqilvmlemtpqrgdvytchvehpslqnpiivewraqs
Timeline for d1jk8b1: