Lineage for d1jk7a_ (1jk7 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513496Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)
  6. 513502Protein Protein phosphatase-1 (PP-1) [56311] (3 species)
  7. 513503Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (3 PDB entries)
  8. 513504Domain d1jk7a_: 1jk7 A: [63144]

Details for d1jk7a_

PDB Entry: 1jk7 (more details), 1.9 Å

PDB Description: crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1

SCOP Domain Sequences for d1jk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOP Domain Coordinates for d1jk7a_:

Click to download the PDB-style file with coordinates for d1jk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk7a_: