SCOPe 2.07: Domain d1jiba2: 1jib A:503-585

Lineage for d1jiba2 (1jib A:503-585)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1jiba2: 1jib A:503-585 [63070]
   Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3
   complexed with mtt

Details for d1jiba2

PDB Entry: 1jib, 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1jiba2:

Sequence; same for both SEQRES and ATOM records:

>d1jiba2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1jiba2:

• d1jiba2 first appeared in SCOP 1.57
  
• d1jiba2 appears in SCOPe 2.06
  
• d1jiba2 appears in the current release, SCOPe 2.08