Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1jgyh1 (1jgy H:36-250)

  1. Root: SCOP 1.75B
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. Protein Photosynthetic reaction centre [50348] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. Domain d1jgyh1: 1jgy H:36-250 [63026]
    Other proteins in same PDB: d1jgyh2, d1jgyl_, d1jgym_
    complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgyh1

PDB Entry: 1jgy (more details)
PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOP Domain Sequences for d1jgyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgyh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1jgyh1:

Click to download the PDB-style file with coordinates for d1jgyh1.
(The format of our PDB-style files is described here.)

Timeline for d1jgyh1:

d1jgyh1 appears in SCOP 1.75A


d1jgyh1
(click for larger image)


d1jgyh1 in context of chain
Domains from same chain:
d1jgyh2


d1jgyh1 in context of PDB
Domains from other chains:
d1jgyl_, d1jgym_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu