Domain d1jgyl_: 1jgy L:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d1jgyl_ (1jgy L:)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
L and M are probably related to each other
Protein L (light) subunit [81477] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (49 PDB entries)
Uniprot P02954
Domain d1jgyl_: 1jgy L: [63028]
Other proteins in same PDB: d1jgyh1, d1jgyh2, d1jgym_
complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgyl_

PDB Entry: 1jgy (more details)
PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced
PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOP Domain Sequences for d1jgyl_:
Sequence; same for both SEQRES and ATOM records: (download)

>d1jgyl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1jgyl_:

Click to download the PDB-style file with coordinates for d1jgyl_.
(The format of our PDB-style files is described here.)

Timeline for d1jgyl_:
d1jgyl_ appears in SCOP 1.75A

d1jgyl_
(click for larger image)

d1jgyl_ in context of chain

d1jgyl_ in context of PDB
Domains from other chains:
d1jgyh1, d1jgyh2, d1jgym_