Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries) Uniprot P02954 |
Domain d1jgxl_: 1jgx L: [63024] Other proteins in same PDB: d1jgxh1, d1jgxh2, d1jgxm_ complexed with bcl, bph, fe, spo, u10; mutant |
PDB Entry: 1jgx (more details), 3.01 Å
SCOPe Domain Sequences for d1jgxl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgxl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1jgxl_: