![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein M (medium) subunit [81481] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries) Uniprot P02953 |
![]() | Domain d1jgwm_: 1jgw M: [63021] Other proteins in same PDB: d1jgwh1, d1jgwh2, d1jgwl_ complexed with bcl, bph, cdl, fe, spo, u10; mutant |
PDB Entry: 1jgw (more details), 2.8 Å
SCOPe Domain Sequences for d1jgwm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgwm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmledvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d1jgwm_: