Lineage for d1jgqq_ (1jgq Q:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647798Domain d1jgqq_: 1jgq Q: [63010]

Details for d1jgqq_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1jgqq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1jgqq_:

Click to download the PDB-style file with coordinates for d1jgqq_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqq_: