Lineage for d1jgpq_ (1jgp Q:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 272799Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 272800Protein 70S ribosome functional complex [58121] (2 species)
  7. 272864Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 273028Domain d1jgpq_: 1jgp Q: [62989]

Details for d1jgpq_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgpq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1jgpq_:

Click to download the PDB-style file with coordinates for d1jgpq_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpq_: