Lineage for d1jgor_ (1jgo R:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206273Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 206417Domain d1jgor_: 1jgo R: [62969]

Details for d1jgor_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgor_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgor_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1jgor_:

Click to download the PDB-style file with coordinates for d1jgor_.
(The format of our PDB-style files is described here.)

Timeline for d1jgor_: