SCOP 1.63: Domain d1jgoq_: 1jgo Q:

Lineage for d1jgoq_ (1jgo Q:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)

8. Domain d1jgoq_: 1jgo Q: [62968]

Details for d1jgoq_

PDB Entry: 1jgo, 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgoq_:

Sequence; same for both SEQRES and ATOM records:

>d1jgoq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1jgoq_:

• d1jgoq_ first appeared in SCOP 1.57
  
• d1jgoq_ appears in SCOP 1.61
  
• d1jgoq_ appears in SCOP 1.65
  
• d1jgoq_ appears in the current release, SCOPe 2.08