Lineage for d1jfib_ (1jfi B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909666Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins)
  6. 909693Protein Negative cofactor 2, NC2, beta chain [63509] (1 species)
  7. 909694Species Human (Homo sapiens) [TaxId:9606] [63510] (1 PDB entry)
  8. 909695Domain d1jfib_: 1jfi B: [62937]
    Other proteins in same PDB: d1jfia_, d1jfic1, d1jfic2
    protein/DNA complex

Details for d1jfib_

PDB Entry: 1jfi (more details), 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex
PDB Compounds: (B:) Transcription Regulator NC2 beta chain

SCOPe Domain Sequences for d1jfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]}
ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
arqqqaelaqqewlq

SCOPe Domain Coordinates for d1jfib_:

Click to download the PDB-style file with coordinates for d1jfib_.
(The format of our PDB-style files is described here.)

Timeline for d1jfib_: