| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins) |
| Protein Negative cofactor 2, NC2, beta chain [63509] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63510] (1 PDB entry) |
| Domain d1jfib_: 1jfi B: [62937] Other proteins in same PDB: d1jfia_, d1jfic1, d1jfic2 protein/DNA complex |
PDB Entry: 1jfi (more details), 2.62 Å
SCOPe Domain Sequences for d1jfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]}
ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
arqqqaelaqqewlq
Timeline for d1jfib_: