Lineage for d1jfib_ (1jfi B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151140Family a.22.1.3: TBP-associated factors, TAFs [47134] (6 proteins)
  6. 151144Protein Negative cofactor 2, NC2, beta chain [63509] (1 species)
  7. 151145Species Human (Homo sapiens) [TaxId:9606] [63510] (1 PDB entry)
  8. 151146Domain d1jfib_: 1jfi B: [62937]
    Other proteins in same PDB: d1jfia_, d1jfic1, d1jfic2

Details for d1jfib_

PDB Entry: 1jfi (more details), 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex

SCOP Domain Sequences for d1jfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens)}
ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
arqqqaelaqqewlq

SCOP Domain Coordinates for d1jfib_:

Click to download the PDB-style file with coordinates for d1jfib_.
(The format of our PDB-style files is described here.)

Timeline for d1jfib_: