SCOP 1.67: Domain d1jehb2: 1jeh B:161-282

Lineage for d1jehb2 (1jeh B:161-282)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Dihydrolipoamide dehydrogenase [51959] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63950] (1 PDB entry)

8. Domain d1jehb2: 1jeh B:161-282 [62916]
   Other proteins in same PDB: d1jeha3, d1jehb3
   complexed with fad

Details for d1jehb2

PDB Entry: 1jeh, 2.4 Å

PDB Description: crystal structure of yeast e3, lipoamide dehydrogenase

SCOP Domain Sequences for d1jehb2:

Sequence; same for both SEQRES and ATOM records:

>d1jehb2 c.3.1.5 (B:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
pgieideekivsstgalslkeipkrltiigggiiglemgsvysrlgskvtvvefqpqiga
smdgevakatqkflkkqgldfklstkvisakrnddknvveivvedtktnkqenleaevll
va

Timeline for d1jehb2:

• d1jehb2 first appeared in SCOP 1.57
  
• d1jehb2 appears in SCOP 1.65
  
• d1jehb2 appears in SCOP 1.69
  
• d1jehb2 appears in the current release, SCOPe 2.08