![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Domain d1jehb2: 1jeh B:161-282 [62916] Other proteins in same PDB: d1jeha1, d1jeha3, d1jehb1, d1jehb3 complexed with fad |
PDB Entry: 1jeh (more details), 2.4 Å
SCOPe Domain Sequences for d1jehb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jehb2 c.3.1.5 (B:161-282) Dihydrolipoamide dehydrogenase, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pgieideekivsstgalslkeipkrltiigggiiglemgsvysrlgskvtvvefqpqiga smdgevakatqkflkkqgldfklstkvisakrnddknvveivvedtktnkqenleaevll va
Timeline for d1jehb2: