![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein D-glucarate dehydratase [54831] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54833] (6 PDB entries) |
![]() | Domain d1jdfc2: 1jdf C:5-137 [62902] Other proteins in same PDB: d1jdfa1, d1jdfb1, d1jdfc1, d1jdfd1 |
PDB Entry: 1jdf (more details), 2 Å
SCOP Domain Sequences for d1jdfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdfc2 d.54.1.1 (C:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll gqhlgvnvasllg
Timeline for d1jdfc2: