Lineage for d1jdfc2 (1jdf C:5-137)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170946Protein D-glucarate dehydratase [54831] (2 species)
  7. 2170947Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. 2170960Domain d1jdfc2: 1jdf C:5-137 [62902]
    Other proteins in same PDB: d1jdfa1, d1jdfb1, d1jdfc1, d1jdfd1
    complexed with glr, ipa, mg; mutant

Details for d1jdfc2

PDB Entry: 1jdf (more details), 2 Å

PDB Description: Glucarate Dehydratase from E.coli N341D mutant
PDB Compounds: (C:) glucarate dehydratase

SCOPe Domain Sequences for d1jdfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdfc2 d.54.1.1 (C:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOPe Domain Coordinates for d1jdfc2:

Click to download the PDB-style file with coordinates for d1jdfc2.
(The format of our PDB-style files is described here.)

Timeline for d1jdfc2: