Lineage for d1jcfa2 (1jcf A:141-336)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995377Protein Prokaryotic actin homolog MreB [64087] (1 species)
  7. 995378Species Thermotoga maritima [TaxId:2336] [64088] (3 PDB entries)
  8. 995380Domain d1jcfa2: 1jcf A:141-336 [62879]

Details for d1jcfa2

PDB Entry: 1jcf (more details), 2.1 Å

PDB Description: mreb from thermotoga maritima, trigonal
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d1jcfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcfa2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige
rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives
vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag
mvldkvnilkklqgag

SCOPe Domain Coordinates for d1jcfa2:

Click to download the PDB-style file with coordinates for d1jcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1jcfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcfa1