Lineage for d1jcfa2 (1jcf A:141-336)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124368Protein Prokaryotic actin homolog MreB [64087] (1 species)
  7. 124369Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries)
  8. 124371Domain d1jcfa2: 1jcf A:141-336 [62879]

Details for d1jcfa2

PDB Entry: 1jcf (more details), 2.1 Å

PDB Description: mreb from thermotoga maritima, trigonal

SCOP Domain Sequences for d1jcfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcfa2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima}
lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige
rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives
vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag
mvldkvnilkklqgag

SCOP Domain Coordinates for d1jcfa2:

Click to download the PDB-style file with coordinates for d1jcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1jcfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcfa1