Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries) |
Domain d1jbbb_: 1jbb B: [62843] |
PDB Entry: 1jbb (more details), 2 Å
SCOPe Domain Sequences for d1jbbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbbb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla ndvaedwikneqgakakarewtklyak
Timeline for d1jbbb_: