Lineage for d1jb9a2 (1jb9 A:163-316)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482261Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482262Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 482263Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 482272Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 482312Species Maize (Zea mays), root isoform [TaxId:4577] [63974] (1 PDB entry)
  8. 482313Domain d1jb9a2: 1jb9 A:163-316 [62841]
    Other proteins in same PDB: d1jb9a1

Details for d1jb9a2

PDB Entry: 1jb9 (more details), 1.7 Å

PDB Description: crystal structure of the ferredoxin:nadp+ reductase from maize root at 1.7 angstroms

SCOP Domain Sequences for d1jb9a2:

Sequence, based on SEQRES records: (download)

>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform}
dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy
lkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcglkgmmpg
iqdtlkkvaerrgeswdqklaqlkknkqwhvevy

Sequence, based on observed residues (ATOM records): (download)

>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform}
dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy
lkqypdnfrydkalsreqkgkmyvqdkieeysdeifklldggahiyfcglkgmmpgiqdt
lkkvaerrgeswdqklaqlkknkqwhvevy

SCOP Domain Coordinates for d1jb9a2:

Click to download the PDB-style file with coordinates for d1jb9a2.
(The format of our PDB-style files is described here.)

Timeline for d1jb9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jb9a1