Lineage for d1jb9a2 (1jb9 A:163-316)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) Species Maize (Zea mays), root isoform [TaxId:4577] [63974] (1 PDB entry) 
Domain d1jb9a2: 1jb9 A:163-316 [62841]
Other proteins in same PDB: d1jb9a1
Details for d1jb9a2
PDB Entry: 1jb9 (more details), 1.7 Å
PDB Description: crystal structure of the ferredoxin:nadp+ reductase from maize root at 1.7 angstroms
SCOP Domain Sequences for d1jb9a2:
Sequence, based on SEQRES records: (download)
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform}
dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy
lkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcglkgmmpg
iqdtlkkvaerrgeswdqklaqlkknkqwhvevy
Sequence, based on observed residues (ATOM records): (download)
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform}
dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy
lkqypdnfrydkalsreqkgkmyvqdkieeysdeifklldggahiyfcglkgmmpgiqdt
lkkvaerrgeswdqklaqlkknkqwhvevy
SCOP Domain Coordinates for d1jb9a2:
Click to download the PDB-style file with coordinates for d1jb9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jb9a2:
- d1jb9a2 is new in SCOP 1.57
- d1jb9a2 appears in SCOP 1.59
- d1jb9a2 appears in the current release, SCOPe 2.07
View in 3D
