Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (4 proteins) |
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) |
Species Maize (Zea mays), root isoform [TaxId:4577] [63974] (1 PDB entry) |
Domain d1jb9a2: 1jb9 A:163-316 [62841] Other proteins in same PDB: d1jb9a1 complexed with fad |
PDB Entry: 1jb9 (more details), 1.7 Å
SCOP Domain Sequences for d1jb9a2:
Sequence, based on SEQRES records: (download)
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform} dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy lkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcglkgmmpg iqdtlkkvaerrgeswdqklaqlkknkqwhvevy
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform} dpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllydeeftsy lkqypdnfrydkalsreqkgkmyvqdkieeysdeifklldggahiyfcglkgmmpgiqdt lkkvaerrgeswdqklaqlkknkqwhvevy
Timeline for d1jb9a2: