Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (1 family) |
Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (1 protein) |
Protein Photosystem I reaction center subunit XI, PsaL [81566] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [81565] (1 PDB entry) |
Domain d1jb0l_: 1jb0 L: [62829] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0l_ f.31.1.1 (L:) Photosystem I reaction center subunit XI, PsaL {Synechococcus elongatus [TaxId: 32046]} lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag ffvgamgsafvaffllenflvvdgimtglfn
Timeline for d1jb0l_: