Lineage for d1jb0l_ (1jb0 L:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620929Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 620930Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (1 family) (S)
  5. 620931Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (1 protein)
  6. 620932Protein Photosystem I reaction center subunit XI, PsaL [81566] (1 species)
  7. 620933Species Synechococcus elongatus [TaxId:32046] [81565] (1 PDB entry)
  8. 620934Domain d1jb0l_: 1jb0 L: [62829]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0l_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0l_ f.31.1.1 (L:) Photosystem I reaction center subunit XI, PsaL {Synechococcus elongatus}
lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv
klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag
ffvgamgsafvaffllenflvvdgimtglfn

SCOP Domain Coordinates for d1jb0l_:

Click to download the PDB-style file with coordinates for d1jb0l_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0l_: