SCOP 1.71: Domain d1jb0k_: 1jb0 K:

Lineage for d1jb0k_ (1jb0 K:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.30: Photosystem I reaction center subunit X, PsaK [81564] (1 superfamily)
   core: hairpin of two transmembrane helices

4. Superfamily f.30.1: Photosystem I reaction center subunit X, PsaK [81563] (1 family)

5. Family f.30.1.1: Photosystem I reaction center subunit X, PsaK [81562] (1 protein)

6. Protein Photosystem I reaction center subunit X, PsaK [81561] (1 species)

7. Species Synechococcus elongatus [TaxId:32046] [81560] (1 PDB entry)

8. Domain d1jb0k_: 1jb0 K: [62828]
   Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0l_, d1jb0m_, d1jb0x_
   complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0k_

PDB Entry: 1jb0, 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0k_:

Sequence, based on SEQRES records:

>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus}
ilcnlfaialgryaiqsrgkgpglpialpalfegfglpellattsfghllaagvvsgl

Sequence, based on observed residues (ATOM records):

>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus}
ilcnlfaialgryiqsrgkgpglglpellattsfghllaagvvsgl

Timeline for d1jb0k_:

• d1jb0k_ first appeared in SCOP 1.57
  
• d1jb0k_ appears in SCOP 1.69
  
• d1jb0k_ appears in SCOP 1.73
  
• d1jb0k_ appears in the current release, SCOPe 2.08